PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009605084.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family CO-like
Protein Properties Length: 412aa    MW: 45247.2 Da    PI: 5.3505
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009605084.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box19.61.9e-06444539
        zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                    +C+ ++e++ + +C+++  +lC +C  + H+       H++
  XP_009605084.1  4 ICEFCGEQRSIVYCRSDAACLCLSCDRNVHSAnalserHSR 44
                    7*****************************65777777776 PP

2zf-B_box22.91.7e-074678436
        zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg 36
                     +C++++++++   C + ++ lC++C  ++H +
  XP_009605084.1 46 LICERCNSQPAVVRCIEEKTSLCQNCDWSGHAS 78
                    68*****************************65 PP

3CCT59.79.7e-21356399144
             CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                     R +a+lRYkeK+ktRkF+K++rY sRKa+A+ R RvKGrFvk+ 
  XP_009605084.1 356 RSNAVLRYKEKKKTRKFDKRVRYVSRKARADVRRRVKGRFVKAG 399
                     899**************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.428147IPR000315B-box-type zinc finger
CDDcd000219.38E-8447No hitNo description
SMARTSM003366.0E-7447IPR000315B-box-type zinc finger
PROSITE profilePS501198.7744391IPR000315B-box-type zinc finger
CDDcd000210.001124773No hitNo description
PfamPF062033.3E-15356398IPR010402CCT domain
PROSITE profilePS5101715.021356398IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MGYICEFCGE QRSIVYCRSD AACLCLSCDR NVHSANALSE RHSRTLICER CNSQPAVVRC  60
IEEKTSLCQN CDWSGHASSS SSGSTHMRQA LSSYTGCPSA AELSNSWSFL LDDPSIGASC  120
EQRMGTMSIK DNRPRDGQSP QGKENSQNMR AAVEVNDMDI SEKSNLLVES STPTLDNKQH  180
NVEPPIRSSN SAMSKGGYMG AKGSSLFEED PYCDNLIMDA VDLSIENYEE LFGASLNYPD  240
ELFENENFDD LFGMKDIKSA DSNCRGANAA EGSSIARVNT VQPTCSNAES ADSAMSCKTD  300
SILYFARQSS LSFSNQTGES TAGDHQDCGV SPMLVMGEPP PWGPPCPEPS SPSTSRSNAV  360
LRYKEKKKTR KFDKRVRYVS RKARADVRRR VKGRFVKAGD AYDYDPLPTR SY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754511e-153HG975451.1 Solanum pennellii chromosome ch12, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009605082.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9-like
RefseqXP_009605083.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9-like
RefseqXP_009605084.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9-like
SwissprotQ9SSE51e-129COL9_ARATH; Zinc finger protein CONSTANS-LIKE 9
TrEMBLA0A0V0ILA20.0A0A0V0ILA2_SOLCH; Putative zinc finger protein CONSTANS-LIKE 9-like
STRINGPGSC0003DMT4000741420.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G07650.42e-90CONSTANS-like 9